Now livetag icon
The official Gen AI Landscape report for 2026 is here. Don’t miss out!Get your copybanner icon
Castle View Enterprise Academy

July 2026

  • Home
  • Castle View Enterprise Academy

Castle View Enterprise A... Market Share Analysis for July 2026

Castle View Enterprise Academy is a Sponsored Academy in Sunderland, England.
Industry: N/A
Year Founded--
Employees51 - 200
Annual Revenue$1M - $2M
castleviewenterpriseacademy.co.uk
Castle View Enterprise Academy
Castle View Enterprise Academy (including company regionals)
  • castleviewenterpriseacademy.co.uk
    castleviewenterpriseacademy.co.uk
See more website traffic and engagement information

Castle View Enterprise Academy Revenue up to July 2026 is 1M - 2M

revenue generated by Castle View Enterprise Academy top domains

Castle View Enterprise Academy top domains revenue over 3 years

Revenue for Castle View Enterprise Academy top domains

castleviewenterpriseacademy.co.ukcastleviewenterpriseacademy.co.uk1M - 2M
See more with Sales Intelligence

Total visits to Castle View Enterprise Academy's top domains

Understand Castle View Enterprise Academy market share and potential market reach.

Total visits last 3 months

Subsidiaries Breakdown
castleviewenterpriseacademy.co.ukcastleviewenterpriseacademy.co.uk1.2K
See more with Sales Intelligence

Avg. visit duration in Castle View Enterprise Academy's top domains

Analyze Castle View Enterprise Academy engagement metrics.

Average visit duration last 3 months

Subsidiaries Breakdown
castleviewenterpriseacademy.co.ukcastleviewenterpriseacademy.co.uk00:00:45
See more with Sales Intelligence

Avg. pageviews on Castle View Enterprise Academy's top domains

See how Castle View Enterprise Academy keep users engaged, nurture their interest, and encourage them to take the next step.

Average page views last 3 months

Subsidiaries Breakdown
castleviewenterpriseacademy.co.ukcastleviewenterpriseacademy.co.uk1.98
See more with Sales Intelligence

Want to gain deeper traffic insights?

Filter 20.3M+ online businesses. Discover new leads when their traffic spikes, when they start or stop using technologies, or when they get positive press.


Castle View Enterprise Academy top competitors by domain

Looks like there’s not enough data here

No Data to Display

Benchmark Your Digital Performance

Identify high-value opportunities, track your performance, and win your market.


Top technologies used by Castle View Enterprise Academy

These are the website technologies, by industry, used by Castle View Enterprise Academy top domains

Payment & Currencies (10)

Cart Functionality

Cart Functionality

Advertising (3)

Google Adsense

Google Adsense

Conversion & Analytics (2)

Google Analytics

Google Analytics

eCommerce (2)

OpenCart

OpenCart

More Technologies

7

See all

Ready to discover high quality prospects?

Identify what technologies a website uses to craft the perfect sales pitch, and shorten the sales cycle with the Similarweb Sales Intelligence Solution.


News & Signals from Castle View Enterprise Academy

With Similarweb Sales signals alerts, you’ll receive daily updates of recognized buying signals whenever new opportunities or threats arise in your target audience.

NewsCastleviewenterpriseacademy receives award Gold Award.Castleviewenterpriseacademy is delighted to have been awarded the Gold Award which recognises the fantastic work its Careers Ambassadors do in promoting careers education at CVEA.

See all Castle View Enterprise Academy signals

Focus your sales teams on the most promising opportunities. By prioritizing opportunities and engaging at the right time, you can optimize efforts and close more deals.