Enterprise
Pricing
Explore API
Get a demo
Get started
Now livetag icon
2026 State of Ecommerce: Own the AI Shopper Journey.Download Reportbanner icon
Fidelity Warranty Services

August 2026

  • Home
  • Fidelity Warranty Services

Fidelity Warranty Services Market Share Analysis for August 2026

Vehicles > Vehicles - Other
Domainfidelitywarrantyservices.com
Year Founded--
Employees51 - 200
Annual Revenue$25M - $50M
HQ:United States, Florida, Deerfield Beach
fidelitywarrantyservices.com
Fidelity Warranty Services
Fidelity Warranty Services (including company regionals)
  • fidelitywarrantyservices.com
    fidelitywarrantyservices.com
See more website traffic and engagement information

Fidelity Warranty Services Revenue up to August 2026 is 25M - 50M

revenue generated by Fidelity Warranty Services top domains

Fidelity Warranty Services top domains revenue over 3 years

Revenue for Fidelity Warranty Services top domains

fidelitywarrantyservices.comfidelitywarrantyservices.com25M - 50M
See more with Sales Intelligence

Total visits to Fidelity Warranty Services's top domains

Understand Fidelity Warranty Services market share and potential market reach.

Total visits last 3 months

Subsidiaries Breakdown
fidelitywarrantyservices.comfidelitywarrantyservices.com53.7K
See more with Sales Intelligence

Avg. visit duration in Fidelity Warranty Services's top domains

Analyze Fidelity Warranty Services engagement metrics.

Average visit duration last 3 months

Subsidiaries Breakdown
fidelitywarrantyservices.comfidelitywarrantyservices.com00:01:45
See more with Sales Intelligence

Avg. pageviews on Fidelity Warranty Services's top domains

See how Fidelity Warranty Services keep users engaged, nurture their interest, and encourage them to take the next step.

Average page views last 3 months

Subsidiaries Breakdown
fidelitywarrantyservices.comfidelitywarrantyservices.com2.77
See more with Sales Intelligence

Want to gain deeper traffic insights?

Filter 20.3M+ online businesses. Discover new leads when their traffic spikes, when they start or stop using technologies, or when they get positive press.

Fidelity Warranty Services top competitors by domain

Top similar sites in August 2026, ranked by their affinity

Benchmark Your Digital Performance

Identify high-value opportunities, track your performance, and win your market.

Top technologies used by Fidelity Warranty Services

These are the website technologies, by industry, used by Fidelity Warranty Services top domains

Conversion & Analytics (3)

Google Analytics

Google Analytics

See all

Advertising (2)

DoubleClick

DoubleClick

See all

Audio Video Media (2)

YouTube

YouTube

See all

Mobile (2)

Meta Viewport

Meta Viewport

See all

More Technologies

3

See all

Ready to discover high quality prospects?

Identify what technologies a website uses to craft the perfect sales pitch, and shorten the sales cycle with the Similarweb Sales Intelligence Solution.