Enterprise
Pricing
Explore API
Get a demo
Get started
Now livetag icon
The official Gen AI Landscape report for 2026 is here. Don’t miss out!Get your copybanner icon
Kids First Therapy

July 2026

  • Home
  • Kids First Therapy

Kids First Therapy Market Share Analysis for July 2026

Industry: N/A
Domainkidsfirsttherapyservices.net
Year Founded--
Employees51 - 200
Annual Revenue$15M - $25M
HQ:United States, North Carolina, Morganton
kidsfirsttherapyservices.net
Kids First Therapy
Kids First Therapy (including company regionals)
  • kidsfirsttherapyservices.net
    kidsfirsttherapyservices.net
See more website traffic and engagement information

Kids First Therapy Revenue up to July 2026 is 15M - 25M

revenue generated by Kids First Therapy top domains

Kids First Therapy top domains revenue over 3 years

Revenue for Kids First Therapy top domains

kidsfirsttherapyservices.netkidsfirsttherapyservices.net15M - 25M
See more with Sales Intelligence

Total visits to Kids First Therapy's top domains

Understand Kids First Therapy market share and potential market reach.

Total visits last 3 months

No Data to Display

No Data to Display

Avg. visit duration in Kids First Therapy's top domains

Analyze Kids First Therapy engagement metrics.

Average visit duration last 3 months

No Data to Display

No Data to Display

Avg. pageviews on Kids First Therapy's top domains

See how Kids First Therapy keep users engaged, nurture their interest, and encourage them to take the next step.

Average page views last 3 months

No Data to Display

No Data to Display

Want to gain deeper traffic insights?

Filter 20.3M+ online businesses. Discover new leads when their traffic spikes, when they start or stop using technologies, or when they get positive press.

Kids First Therapy top competitors by domain

Looks like there’s not enough data here

No Data to Display

Benchmark Your Digital Performance

Identify high-value opportunities, track your performance, and win your market.

Top technologies used by Kids First Therapy

These are the website technologies, by industry, used by Kids First Therapy top domains

Social (2)

Facebook Connect

Facebook Connect

See all

Widget (2)

Twemoji

Twemoji

See all

Advocacy (1)

BBB Seals

BBB Seals

Content Management System (1)

WordPress

WordPress

More Technologies

3

See all

Ready to discover high quality prospects?

Identify what technologies a website uses to craft the perfect sales pitch, and shorten the sales cycle with the Similarweb Sales Intelligence Solution.