June 2026
Create an account to continue using Similarweb
View website metrics, keywords, top marketing channels, market research tools, and more.
Create your free accountbiolabshop.eu
Global Rank
#461,310
7,893Showing Similarweb estimated data.
Publicly validate your site’s metrics by connecting your GA4
Reflect your success
Verify your website's traffic and engagement metrics by connecting to Google Analytics
Bounce Rate
51.19%
Pages per Visit
4.85
Avg Visit Duration
00:02:35
- Company
- - -
- Industry
- - -
Top 10 biolabshop.eu Competitors
The Top 10 Sites Like biolabshop.eu in June 2026 are ranked by their affinity to biolabshop.eu in terms of keyword traffic, audience targeting, and market overlap
Your trusted nutrition & gym supplement store 🔥 Shop peptides, SARMs, nootropics and cosmetics with peptides in our online store USA & Canada! ✔️
- Company
- - -
- Industry
- - -
Bounce Rate
52%
Pages per Visit
1.62
Avg Visit Duration
00:00:20
Similarity Score
100%BioLabs empowers innovation worldwide by offering life science entrepreneurs a premier innovation support platform centered around fully supported co-working lab facilities for biotech startups and access to a global network of partners. BioLabs is located in key innovation clusters worldwide, including Boston, Cambridge, New Haven, New York City, Princeton, Philadelphia, Raleigh-Durham, Dallas, San Diego, Los Angeles, Paris, Paris-Saclay, Heidelberg, Berlin, and Kawasaki.
- Company
- BioLabs
- Industry
- Science and Education > Biology
Global Rank
#877,904
57,251Bounce Rate
41.51%
Pages per Visit
2.22
Avg Visit Duration
00:00:31
Similarity Score
89%- Company
- - -
- Industry
- - -
Bounce Rate
14.21%
Pages per Visit
5.78
Avg Visit Duration
00:07:12
Similarity Score
87%Rekombinantes Peptidanalogon zur Untersuchung von Zellwachstum, Signaltransduktion und Rezeptoraktivierung in präklinischen Forschungsmodellen. Allgemeine Beschreibung IGF-1 LR3 (Insulin-like Growth Factor-1 Long R3) ist ein rekombinantes Peptidanalogon des humanen IGF-1 mit einer verlängerten Aminosäuresequenz und einer modifizierten dritten Position (Arg statt Glu). Diese strukturelle Modifikation reduziert die Bindungsaffinität zu IGF-Bindungsproteinen (IGFBPs) und ermöglicht in Forschungsmodellen eine verlängerte Aktivitätsdauer. IGF-1 LR3 wird in der wissenschaftlichen Grundlagenforschung eingesetzt, um Signalmechanismen zu untersuchen, die an Zellwachstum, Differenzierung und Proteinbiosynthese beteiligt sind. Chemische Eigenschaften Reinheit: ≥ 99 % (HPLC-geprüft) Form: lyophilisiertes Pulver Sequenz: MFPAMPLLSRAVLLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKA – (E)LR – GSAGKSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Molekulargewicht: ca. 9117 Da Löslichkeit: wasserlöslich nach Rekonstitution Forschungsrelevanz In präklinischen Modellen wird IGF-1 LR3 eingesetzt, um die Aktivierung der IGF-1-Rezeptoren und nachgeschalteter Signalwege (PI3K/Akt- und MAPK-Kaskaden) zu untersuchen. Das Peptid dient ausschließlich der Grundlagenforschung und der Analyse Peptid-vermittelter Zellprozesse wie Wachstum, Differenzierung und Stoffwechselregulation. Lagerung & Handhabung Kühl (2 – 8 °C) und trocken lagern. Nach Rekonstitution aliquotieren und bei −20 °C aufbewahren, um die strukturelle Stabilität des Peptids zu bewahren. Analysenzertifikat (COA) Jede Charge von IGF-1 LR3 wird mittels HPLC- und Massenspektrometrie-Analysen verifiziert. Das entsprechende COA steht chargenbezogen im Downloadbereich zur Verfügung. Hinweis & Haftungsausschluss Dieses Produkt ist ausschließlich für Forschungszwecke bestimmt. Nicht zur Anwendung am Menschen oder Tier, nicht für diagnostische oder therapeutische Zwecke geeignet.
- Company
- - -
- Industry
- - -
Bounce Rate
40.23%
Pages per Visit
2.93
Avg Visit Duration
00:00:58
Similarity Score
82%PRISM BioLab introduces PepMetics Technology, a proprietary drug discovery platform. where its molecules are designed to mimic α-helix or β-turn peptides.
- Company
- - -
- Industry
- - -
Global Rank
#2,187,654
888,892Bounce Rate
74.13%
Pages per Visit
1.25
Avg Visit Duration
00:00:08
Similarity Score
80%- Company
- - -
- Industry
- - -
Bounce Rate
43.39%
Pages per Visit
1.95
Avg Visit Duration
00:03:36
Similarity Score
78%Hayvan Genom Dizileme
- Company
- - -
- Industry
- - -
Bounce Rate
54.9%
Pages per Visit
1.62
Avg Visit Duration
00:00:43
Similarity Score
76%Synthagen is an innovative company that has created peptide synthesis technology - NL-PEPTIDES™. With us, you can buy premium dietary supplements of the highest quality!
- Company
- - -
- Industry
- - -
Global Rank
#675,912
137,072Bounce Rate
38.91%
Pages per Visit
2.48
Avg Visit Duration
00:01:00
Similarity Score
74%DAYbyDAY Balsam do ciała o przyjemnym zapachu imbiru z pomarańczą to produkt zawierający w swoim składzie, aż 98 % składników pochodzenia naturalnego. Produkt przebadany dermatologicznie. Ma bardzo bogaty i naturalny skład: Olej z oliwek – nawilża, zmiękcza i wygładza skórę Gliceryna – utrzymuje długotrwałe nawilżenie skóry
- Company
- - -
- Industry
- - -
Bounce Rate
66.66%
Pages per Visit
1.89
Avg Visit Duration
00:00:58
Similarity Score
68%Proteine/Eiweisse bilden die Grundbausteine für Muskelaufbau und -erhalt. Sie spielen nicht nur eine entscheidende Rolle für die Erholung der Muskulatur, sondern verleihen dem Körper seine ganze Struktur, sichtbar als Haut, Muskeln, Nägel, Knochen, Bänder und viele weitere organische Strukturen. Auch Hormone und Enzyme
- Company
- - -
- Industry
- - -
Global Rank
#1,127,819
412,339Bounce Rate
49.58%
Pages per Visit
3.23
Avg Visit Duration
00:01:05
Similarity Score
66%biolabshop.eu's top 5 competitors in June 2026 are: mybiolabshop.com, biolabs.io, loopbiolabs.com, ultimatebiolabs.com, and more.
According to Similarweb data of monthly visits, biolabshop.eu’s top competitor in June 2026 is mybiolabshop.com. biolabshop.eu 2nd most similar site is biolabs.io, and closing off the top 3 is loopbiolabs.com.
ultimatebiolabs.com ranks as the 4th most similar website to biolabshop.eu and prismbiolab.com ranks fifth in June 2026.
The other five competitors in the top 10 list are bioshopcanada.com, bmlabosis.com, synthagenlabs.com, recepta.pl, and sponser.de.