junho 2026
Crie uma conta para continuar usando a Similarweb
Veja métricas do site, palavras-chave, principais canais de marketing, ferramentas de pesquisa de mercado e muito mais.
Create your free accountbiolabshop.eu
Classificação Global
#461,310
7,893Mostrando dados estimados da Similarweb.
Valide publicamente as métricas do seu site conectando seu GA4
Demonstre seu sucesso
Verifique as métricas de tráfego e engajamento do seu site, conectando-se ao Google Analytics
Taxa de Rejeição
51.19%
Páginas por Visita
4.85
Duração Média da Visita
00:02:35
- Empresa
- - -
- Setor
- - -
10 principais biolabshop.eu concorrentes
Os 10 principais sites como biolabshop.eu em junho 2026 são classificados por sua afinidade com biolabshop.eu em termos de tráfego de palavras-chave, segmentação de público-alvo e sobreposição de mercado
Your trusted nutrition & gym supplement store 🔥 Shop peptides, SARMs, nootropics and cosmetics with peptides in our online store USA & Canada! ✔️
- Empresa
- - -
- Setor
- - -
Classificação Global
#1,518,013
375,770Classificação por Categoria
- -
Taxa de Rejeição
52%
Páginas por Visita
1.62
Duração Média da Visita
00:00:20
Pontuação de semelhanças
100%BioLabs empowers innovation worldwide by offering life science entrepreneurs a premier innovation support platform centered around fully supported co-working lab facilities for biotech startups and access to a global network of partners. BioLabs is located in key innovation clusters worldwide, including Boston, Cambridge, New Haven, New York City, Princeton, Philadelphia, Raleigh-Durham, Dallas, San Diego, Los Angeles, Paris, Paris-Saclay, Heidelberg, Berlin, and Kawasaki.
- Empresa
- BioLabs
Classificação Global
#877,904
57,251Taxa de Rejeição
41.51%
Páginas por Visita
2.22
Duração Média da Visita
00:00:31
Pontuação de semelhanças
89%- Empresa
- - -
- Setor
- - -
Classificação Global
#3,676,501
262,401Classificação por Categoria
- -
Taxa de Rejeição
14.21%
Páginas por Visita
5.78
Duração Média da Visita
00:07:12
Pontuação de semelhanças
87%Rekombinantes Peptidanalogon zur Untersuchung von Zellwachstum, Signaltransduktion und Rezeptoraktivierung in präklinischen Forschungsmodellen. Allgemeine Beschreibung IGF-1 LR3 (Insulin-like Growth Factor-1 Long R3) ist ein rekombinantes Peptidanalogon des humanen IGF-1 mit einer verlängerten Aminosäuresequenz und einer modifizierten dritten Position (Arg statt Glu). Diese strukturelle Modifikation reduziert die Bindungsaffinität zu IGF-Bindungsproteinen (IGFBPs) und ermöglicht in Forschungsmodellen eine verlängerte Aktivitätsdauer. IGF-1 LR3 wird in der wissenschaftlichen Grundlagenforschung eingesetzt, um Signalmechanismen zu untersuchen, die an Zellwachstum, Differenzierung und Proteinbiosynthese beteiligt sind. Chemische Eigenschaften Reinheit: ≥ 99 % (HPLC-geprüft) Form: lyophilisiertes Pulver Sequenz: MFPAMPLLSRAVLLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKA – (E)LR – GSAGKSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Molekulargewicht: ca. 9117 Da Löslichkeit: wasserlöslich nach Rekonstitution Forschungsrelevanz In präklinischen Modellen wird IGF-1 LR3 eingesetzt, um die Aktivierung der IGF-1-Rezeptoren und nachgeschalteter Signalwege (PI3K/Akt- und MAPK-Kaskaden) zu untersuchen. Das Peptid dient ausschließlich der Grundlagenforschung und der Analyse Peptid-vermittelter Zellprozesse wie Wachstum, Differenzierung und Stoffwechselregulation. Lagerung & Handhabung Kühl (2 – 8 °C) und trocken lagern. Nach Rekonstitution aliquotieren und bei −20 °C aufbewahren, um die strukturelle Stabilität des Peptids zu bewahren. Analysenzertifikat (COA) Jede Charge von IGF-1 LR3 wird mittels HPLC- und Massenspektrometrie-Analysen verifiziert. Das entsprechende COA steht chargenbezogen im Downloadbereich zur Verfügung. Hinweis & Haftungsausschluss Dieses Produkt ist ausschließlich für Forschungszwecke bestimmt. Nicht zur Anwendung am Menschen oder Tier, nicht für diagnostische oder therapeutische Zwecke geeignet.
- Empresa
- - -
- Setor
- - -
Classificação Global
#1,545,225
435,701Classificação por Categoria
- -
Taxa de Rejeição
40.23%
Páginas por Visita
2.93
Duração Média da Visita
00:00:58
Pontuação de semelhanças
82%PRISM BioLab introduces PepMetics Technology, a proprietary drug discovery platform. where its molecules are designed to mimic α-helix or β-turn peptides.
- Empresa
- - -
- Setor
- - -
Classificação Global
#2,187,654
888,892Taxa de Rejeição
74.13%
Páginas por Visita
1.25
Duração Média da Visita
00:00:08
Pontuação de semelhanças
80%- Empresa
- - -
- Setor
- - -
Classificação Global
#1,728,505
289,276Taxa de Rejeição
43.39%
Páginas por Visita
1.95
Duração Média da Visita
00:03:36
Pontuação de semelhanças
78%Hayvan Genom Dizileme
- Empresa
- - -
- Setor
- - -
Classificação Global
#2,796,811
505,176Taxa de Rejeição
54.9%
Páginas por Visita
1.62
Duração Média da Visita
00:00:43
Pontuação de semelhanças
76%Synthagen is an innovative company that has created peptide synthesis technology - NL-PEPTIDES™. With us, you can buy premium dietary supplements of the highest quality!
- Empresa
- - -
- Setor
- - -
Classificação Global
#675,912
137,072Taxa de Rejeição
38.91%
Páginas por Visita
2.48
Duração Média da Visita
00:01:00
Pontuação de semelhanças
74%DAYbyDAY Balsam do ciała o przyjemnym zapachu imbiru z pomarańczą to produkt zawierający w swoim składzie, aż 98 % składników pochodzenia naturalnego. Produkt przebadany dermatologicznie. Ma bardzo bogaty i naturalny skład: Olej z oliwek – nawilża, zmiękcza i wygładza skórę Gliceryna – utrzymuje długotrwałe nawilżenie skóry
- Empresa
- - -
- Setor
- - -
Classificação Global
#230,635
19,250Taxa de Rejeição
66.66%
Páginas por Visita
1.89
Duração Média da Visita
00:00:58
Pontuação de semelhanças
68%Proteine/Eiweisse bilden die Grundbausteine für Muskelaufbau und -erhalt. Sie spielen nicht nur eine entscheidende Rolle für die Erholung der Muskulatur, sondern verleihen dem Körper seine ganze Struktur, sichtbar als Haut, Muskeln, Nägel, Knochen, Bänder und viele weitere organische Strukturen. Auch Hormone und Enzyme
- Empresa
- - -
- Setor
- - -
Classificação Global
#1,127,819
412,339Taxa de Rejeição
49.58%
Páginas por Visita
3.23
Duração Média da Visita
00:01:05
Pontuação de semelhanças
66%biolabshop.euOs 5 principais concorrentes de junho 2026 são: mybiolabshop.com, biolabs.io, loopbiolabs.com, ultimatebiolabs.com e muito mais.
De acordo com os dados de visitas mensais da Similarweb, o principal concorrente do biolabshop.eu em junho 2026 é mybiolabshop.com. O segundo site mais semelhante ao biolabshop.eu é biolabs.io, e fechando o top 3 está o loopbiolabs.com.
O ultimatebiolabs.com ocupa o posto de 4º site mais semelhante ao biolabshop.eu e o prismbiolab.com aparece em quinto lugar em junho 2026.
Os outros cinco concorrentes na lista dos 10 principais são bioshopcanada.com, bmlabosis.com, synthagenlabs.com, recepta.pl e sponser.de.